DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:587 Identity:130/587 - (22%)
Similarity:217/587 - (36%) Gaps:167/587 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLIAIAIILATILVFKGVRIFNY-----IDHMAGIMEMIPGPTPYPFVGNLFQ-------FG-- 51
            |.||.:.::....|.|.....::|     |.|:.        |:.:..:|||.|       ||  
  Fly     1 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLP--------PSSWSPMGNLGQLLFLRISFGDL 57

  Fly    52 -----LKPAEYPKKVLQYCRKYDFQGFRSLVFLQYHMMLSDPAEIQNILSSSSLLYKEHLYSFLR 111
                 ..|.....|::         ||  .:|....:|:.||..|:.:|..:   :...|..|..
  Fly    58 FRQLYADPRNGQAKIV---------GF--FIFQTPALMVRDPELIRQVLIKN---FNNFLNRFES 108

  Fly   112 PWLGD--GLLTSSGARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQEVFD--- 171
            ...||  |.||...|:: .|.|.......:....|.:|.|     .:.|.|||.||.::..:   
  Fly   109 ADAGDPMGALTLPLAKY-HHWKESRQCMSQLFTSGRMRDV-----MYSQMLDVASDLEQYLNRKL 167

  Fly   172 AQELVAKCTLDIVCE----NATGQDSSSLN------GETSDLHGAIKDLCDVVQERTFSIVKRFD 226
            ...|.....|..:|:    :.||....|||      |. |:|....|:|.:....:    |..|.
  Fly   168 GDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGGLRRGR-SELITKTKELFNTNPRK----VLDFM 227

  Fly   227 ALFRL------------TSYYMKQRRALSLLRSELNR--IISQRRH-QLAAENTCQQGQPINKPF 276
            ::|.|            |..|.:..|.|.....|..:  :|:|.:| ||:..:......|     
  Fly   228 SVFFLPKWTGVLKPKVFTEDYARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHP----- 287

  Fly   277 LDVLLTAKLDGKVLKEREIIEEVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGE 341
             |.               :..:....:..|.:..:|.:.||||.|::..:||::...|.|    |
  Fly   288 -DF---------------VASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELR----E 332

  Fly   342 NFAGEADLA--RLDQMHYLELIIRETLRLYPSVPLIARTNRNPIDINGTKVAKCTT--------- 395
            .|...|.|:  .|..:.||:::..|.|||||:...:.|              :||:         
  Fly   333 AFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNR--------------ECTSSASEGFSLQ 383

  Fly   396 ------------VIMCLIAMGYNEKYFDDPCTFRPERFENPTGNVGIEAFKSVPFSAGPRRCIAE 448
                        ..:.::.:..:|:::.:||.|.|||| .|..:..|.....:||.|||..||..
  Fly   384 PHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERF-GPERSRHIHPMTYIPFGAGPHGCIGS 447

  Fly   449 KFAMYQMKALLSQLLRRFEILPAVDGLPPGINDHSREDC---VPQSEYDPVLNIRVTLKSENGIQ 510
            :..:.|:|..:..:|:::.:                |.|   |.:..::|.   ...|:|||.|.
  Fly   448 RLGVLQLKLGIVHILKQYWV----------------ETCERTVSEIRFNPK---SFMLESENEIY 493

  Fly   511 IR 512
            :|
  Fly   494 LR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 112/500 (22%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 116/543 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.