DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and Cyp46a1

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_006240610.1 Gene:Cyp46a1 / 362782 RGDID:1306605 Length:500 Species:Rattus norvegicus


Alignment Length:525 Identity:139/525 - (26%)
Similarity:230/525 - (43%) Gaps:74/525 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYP--FVGNLFQFGLKPAEYPKKVLQ 63
            :.|:..|::||..|      ...::.......|.|||| |.|  .:|:|..| .|..|...:|||
  Rat     5 LLLLGSAVLLAFGL------CCTFVHRARSRYEHIPGP-PRPSFLLGHLPYF-WKKDEACGRVLQ 61

  Fly    64 -----YCRKYDFQGFRSLVFLQYHMMLSDPAEIQNILSSS-----SLLYKEHLYSFLRPWLGDGL 118
                 :.:||. ...|..||.:..::::.|..::..|.|:     |.:|:.....|.....|.||
  Rat    62 DVFLDWAKKYG-PVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRAIQTVFGERLFGQGL 125

  Fly   119 LTSSG-ARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQEVFDAQELVAKCTLD 182
            ::... .||.|.:::...||.||::...:...:....|.::.|:..:|.|.....|:::...|:|
  Rat   126 VSECDYGRWYKQRRVMDLAFSRSSLVSLMGTFNEKAEQLMEILEAKADGQTPVSMQDMLTCATID 190

  Fly   183 IVCENATGQDSSSLNGETSDLHGAIKDLCDVVQERTFSIVKRFDALFRLTSYYM----KQ----R 239
            |:.:.|.|.::|.|.|....|..|:|.:.:.:.....::.|           :|    ||    |
  Rat   191 ILAKAAFGMETSMLLGAQKPLSQAVKVMLEGISASRNTLAK-----------FMPGKRKQLREIR 244

  Fly   240 RALSLLRSELNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTAK---LDGKVLKEREIIEEVST 301
            .::.|||......:.:||..|      ::|:.:....|..:|.|:   .|.:||     ::...|
  Rat   245 ESIRLLRQVGKDWVQRRREAL------KRGEDVPADILTQILKAEEGAQDDEVL-----LDNFVT 298

  Fly   302 FIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQMHYLELIIRETL 366
            |...||:..|..::||:..|||..||..:...|...:.|..  ...|...|.::.||..:::|:|
  Rat   299 FFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVVGSK--RHLDYEDLGRLQYLSQVLKESL 361

  Fly   367 RLYPSVPLIARTNRNPIDINGTKVAKCTTVIMCLIAMGYNEKYFDDPCTFRPERF----ENPTGN 427
            ||||......|.......|:|.:|...|.::.....||..:.||:||.||.|:||    ..|   
  Rat   362 RLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKP--- 423

  Fly   428 VGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRRFEILPAVDGLPPGINDHSREDCVPQSE 492
                .|...|||.|.|.||.::||..::|.::::||:|.|.     .|.||.....:|... ...
  Rat   424 ----RFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEF-----RLVPGQRFGLQEQAT-LKP 478

  Fly   493 YDPVL 497
            .||||
  Rat   479 LDPVL 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 124/461 (27%)
Cyp46a1XP_006240610.1 p450 34..466 CDD:278495 126/470 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.