DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and CYP4A22

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:525 Identity:148/525 - (28%)
Similarity:254/525 - (48%) Gaps:55/525 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNL--FQFGLKPAEYPKKVLQY---CR 66
            ::::..:|:.|..:::.:...:...::..|.|..:...|::  ||...:.....::|..:   |.
Human    23 SLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPSACP 87

  Fly    67 KYDFQGFRSLVFLQYHMMLSDPAEIQNILSSSSLLYKEH-LYSFLRPWLGDGLLTSSGARWLKHQ 130
            .:.:.|       :..:.|.||..::.||..|.  .|.| .|.||.|.:|.|||..:|..|.:|:
Human    88 YWIWGG-------KVRVQLYDPDYMKVILGRSD--PKSHGSYKFLAPRIGYGLLLLNGQTWFQHR 143

  Fly   131 KLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQEVFDAQELVAKCTLDIVCENA-TGQDSS 194
            ::..|||....::.|:.::..:....:.|.:.|.......:..:.|:..|||.:.::| :.|.|.
Human   144 RMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKSAFSHQGSI 208

  Fly   195 SLNGETSDLHGAIKDLCDVVQERTFSIVKRF----DALFRLTSYYMKQRRALSLLRSELNRIISQ 255
            .::..:.....||.||..:|    |..::..    |.::.|||......||..|.....:::|..
Human   209 QVDRNSQSYIQAISDLNSLV----FCCMRNAFHENDTIYSLTSAGRWTHRACQLAHQHTDQVIQL 269

  Fly   256 RRHQLAAENTCQQ-GQPINKPFLDVLLTAKLD-GKVLKEREIIEEVSTFIFTGHDPIAAAISFTL 318
            |:.||..|...:: .:..:..|||:||.||:: |.:|.::::..||.||:|.|||..|:.||:.|
Human   270 RKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWIL 334

  Fly   319 YTLSRHSEIQQKAAEEQRRIFGENFAGEADLA--RLDQMHYLELIIRETLRLYPSVPLIARTNRN 381
            |.|:.|.:.|::..||...:.|:.    |.:.  .||||.|..:.|:|.|||||.||.|.|....
Human   335 YALATHPKHQERCREEIHGLLGDG----ASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELST 395

  Fly   382 PIDI-NGTKVAKCTTVIMCLIAMGYNEKYFDDPCTFRPERFENPTGNVGIEAFKSVPFSAGPRRC 445
            |:.. :|..:.|...|::.:..:.:|.|.:.:...|.|.||. |.......||  :|||.|.|.|
Human   396 PVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNLEVFDPSRFA-PGSAQHSHAF--LPFSGGSRNC 457

  Fly   446 IAEKFAMYQMKALLSQLLRRFEILPAVDGLPPGINDHSREDCVPQSEYDPVLNIRVTLKSENGIQ 510
            |.::|||.|:|...:..|.|||:||....:|           :|.:        |:.|||:|||.
Human   458 IGKQFAMNQLKVARALTLLRFELLPDPTRIP-----------IPMA--------RLVLKSKNGIH 503

  Fly   511 IRLRK 515
            :|||:
Human   504 LRLRR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 132/449 (29%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 143/491 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154747
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D214327at33208
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.