DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and CYP19A1

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_000094.2 Gene:CYP19A1 / 1588 HGNCID:2594 Length:503 Species:Homo sapiens


Alignment Length:489 Identity:101/489 - (20%)
Similarity:199/489 - (40%) Gaps:67/489 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPAEYPKKVLQYCRK 67
            ::..|:..||:.|.....:|..:.:..| ...||||.....:|.|...|               :
Human    16 IVPEAMPAATMPVLLLTGLFLLVWNYEG-TSSIPGPGYCMGIGPLISHG---------------R 64

  Fly    68 YDFQGFRSL------VFLQYHMMLSDPAEIQNILSSSSLLY---KEHLYSFLRPWLG-------- 115
            :.:.|..|.      |:.::..:.....|...|..|||:.:   ..|..|.....||        
Human    65 FLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHE 129

  Fly   116 DGLLTSSGAR-WLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQEVFDAQELVAKC 179
            .|::.::... |...:..:..|.....:...:.|...:....:.:|:.:::.....|...|:.:.
Human   130 KGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRV 194

  Fly   180 TLDIVCENATGQDSSSLNGETSDLHGAIKDLCDVVQERTF-----SIVKRFDALFRLTSYYMKQR 239
            .||              ...|..|...:.:...||:.:.:     :::.:.|..|:::..|.|..
Human   195 MLD--------------TSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWLYKKYE 245

  Fly   240 RALSLLRSELNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGKVLKEREIIEEVSTFIF 304
            :::..|:..:..:|:::|.:::.|...::..    .|...|:.|:..|.:.:| .:.:.:...:.
Human   246 KSVKDLKDAIEVLIAEKRRRISTEEKLEECM----DFATELILAEKRGDLTRE-NVNQCILEMLI 305

  Fly   305 TGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQMHYLELIIRETLRLY 369
            ...|.::.::.|.|:.:::|..:::...:|.:.:.||......|:.:|..|   |..|.|::|..
Human   306 AAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVM---ENFIYESMRYQ 367

  Fly   370 PSVPLIARTNRNPIDINGTKVAKCTTVIMCLIAMGYNEKYFDDPCTFRPERFENPTGNVGIEAFK 434
            |.|.|:.|.......|:|..|.|.|.:|:.:..| :..::|..|..|..|.|..   ||....|:
Human   368 PVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRM-HRLEFFPKPNEFTLENFAK---NVPYRYFQ 428

  Fly   435 SVPFSAGPRRCIAEKFAMYQMKALLSQLLRRFEI 468
              ||..|||.|..:..||..|||:|..|||||.:
Human   429 --PFGFGPRGCAGKYIAMVMMKAILVTLLRRFHV 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 94/456 (21%)
CYP19A1NP_000094.2 CYP19A1 72..485 CDD:410709 87/417 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154812
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.