DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and CYP4A11

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:527 Identity:151/527 - (28%)
Similarity:261/527 - (49%) Gaps:51/527 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPAEYPKKVLQY--- 64
            |.|.::::..:|:.|.|:::.:...:...::..|.|..:...|::.:  |:..:..:::.::   
Human    19 LQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQE--LQQDQELQRIQKWVET 81

  Fly    65 ----CRKYDFQGFRSLVFLQYHMMLSDPAEIQNILSSSSLLYKEH-LYSFLRPWLGDGLLTSSGA 124
                |..:.:.|       :..:.|.||..::.||..|.  .|.| .|.||.||:|.|||..:|.
Human    82 FPSACPHWLWGG-------KVRVQLYDPDYMKVILGRSD--PKSHGSYRFLAPWIGYGLLLLNGQ 137

  Fly   125 RWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQEVFDAQELVAKCTLDIVCENA- 188
            .|.:|:::..|||....::.|:.::..:....:.|.:.|.......:..:.|:..|||.:.:.| 
Human   138 TWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAF 202

  Fly   189 TGQDSSSLNGETSDLHGAIKDLCDVVQERTFSIVKRFDALFRLTSYYMKQRRALSLLRSELNRII 253
            :.|.|..::..:.....||.||.::|..|..:...:.|.::.|||......||..|.....:::|
Human   203 SHQGSIQVDRNSQSYIQAISDLNNLVFSRVRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTDQVI 267

  Fly   254 SQRRHQLAAENTCQQ-GQPINKPFLDVLLTAKLD-GKVLKEREIIEEVSTFIFTGHDPIAAAISF 316
            ..|:.||..|...:: .:..:..|||:||.||:: |.:|.::::..||.||:|.|||..|:.||:
Human   268 QLRKAQLQKEGELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISW 332

  Fly   317 TLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLA--RLDQMHYLELIIRETLRLYPSVPLIARTN 379
            .||.|:.|.:.|::..||...:.|:.    |.:.  .||||.|..:.|:|.|||||.||.|.|..
Human   333 ILYALATHPKHQERCREEIHSLLGDG----ASITWNHLDQMPYTTMCIKEALRLYPPVPGIGREL 393

  Fly   380 RNPIDI-NGTKVAKCTTVIMCLIAMGYNEKYFDDPCTFRPERFENPTGNVGIEAFKSVPFSAGPR 443
            ..|:.. :|..:.|...|::.:..:.:|.|.:.:|..|.|.||. |.......||  :|||.|.|
Human   394 STPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNPEVFDPFRFA-PGSAQHSHAF--LPFSGGSR 455

  Fly   444 RCIAEKFAMYQMKALLSQLLRRFEILPAVDGLPPGINDHSREDCVPQSEYDPVLNIRVTLKSENG 508
            .||.::|||.::|...:..|.|||:||          |.:|         .|:...|:.|||:||
Human   456 NCIGKQFAMNELKVATALTLLRFELLP----------DPTR---------IPIPIARLVLKSKNG 501

  Fly   509 IQIRLRK 515
            |.:|||:
Human   502 IHLRLRR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 131/447 (29%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 143/489 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154746
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.