DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp4 and LOC4578106

DIOPT Version :10

Sequence 1:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster
Sequence 2:XP_001238070.3 Gene:LOC4578106 / 4578106 VectorBaseID:AGAMI1_007234 Length:334 Species:Anopheles gambiae


Alignment Length:99 Identity:36/99 - (36%)
Similarity:52/99 - (52%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EVKELVNDVQADGFVSKLVLDNGSAASATGDVHG--------NIDGVFEWVSPEGEHVRVSYKAD 77
            ::||.|.....||:..|...:|...|:.:|.:..        ...|.:|::..:|:..||.|.||
Mosquito   236 KIKEQVKQFNDDGYYYKYANENNIEAAESGKIDDRNTENETLRAKGYYEYIGDDGQKYRVDYVAD 300

  Fly    78 ENGYQPQSDLLPTPPPIPEAILKAIAYIQAHPSK 111
            |||:||..|.||||||.||.|.:|:.||.:...|
Mosquito   301 ENGFQPLGDHLPTPPPTPEPIARALEYIASQQRK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 13/48 (27%)
LOC4578106XP_001238070.3 Chitin_bind_4 249..304 CDD:459790 14/54 (26%)

Return to query results.
Submit another query.