DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp4 and Cpr100A

DIOPT Version :10

Sequence 1:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster


Alignment Length:111 Identity:30/111 - (27%)
Similarity:54/111 - (48%) Gaps:7/111 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKILLVCALVALVAA---NENPEVKELVND---VQADG-FVSKLVLDNGSAASATGDVHGNIDG 58
            ||:.|.:..||||.::   :::|:...::::   :..|| |.:....::|.......|..|...|
  Fly     1 MFRFLALTTLVALASSQHYHQDPKTAAIISEQRYLSGDGKFGAAYEQEDGINFKEETDADGTRHG 65

  Fly    59 VFEWVSPEGEHVRVSYKADENGYQPQSDLLPTPPPIPEAILKAIAY 104
            .:.::.|.|:...:||.|.:||:|...|.||..||.|...:....|
  Fly    66 SYSYLDPTGQRRTISYTAGKNGFQASGDHLPQAPPAPPQPVPTAGY 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 10/40 (25%)
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:459790 10/43 (23%)

Return to query results.
Submit another query.