DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp4 and Cpr97Eb

DIOPT Version :10

Sequence 1:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_651530.1 Gene:Cpr97Eb / 43259 FlyBaseID:FBgn0039481 Length:235 Species:Drosophila melanogaster


Alignment Length:108 Identity:26/108 - (24%)
Similarity:45/108 - (41%) Gaps:20/108 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKILLVCALVALVAANENPEVKELVNDVQADGFVSKLVLDNGS------AAS---------ATG 50
            |.|:.|...|:.|.|.:...:.::....|.....:.| ..|:||      ||.         |.|
  Fly     1 MLKLTLSLGLLLLAAHSAYAQHQDYTTPVPILKQIDK-HNDDGSYTYGYEAADKSFKIETKYANG 64

  Fly    51 DVHGNIDGVFEWVSPEGEHVRVSYKADENGYQPQSDLLPTPPP 93
            :|:|.    :.:|..:|:...:.|.|.:.|::|....:..|||
  Fly    65 EVYGK----YGYVDDQGKVREIEYGASKRGFEPAGSHINVPPP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 13/55 (24%)
Cpr97EbNP_651530.1 Chitin_bind_4 44..91 CDD:459790 10/50 (20%)

Return to query results.
Submit another query.