DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp4 and Cpr72Ea

DIOPT Version :10

Sequence 1:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster


Alignment Length:66 Identity:16/66 - (24%)
Similarity:28/66 - (42%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SAASATGDVHGNIDGVFEWVSPEGEHVRVSYKADENGYQPQSDLLPTPPPIPEAILKAIAYIQAH 108
            |:...|..:.|...|.:.:....|:...|:|.||..|:...:..|| ...:|:..|:......:|
  Fly    58 SSKQETRTLDGITQGYYSYRDAAGKLQTVNYVADNKGFHVAATNLP-KAKVPQESLEFSPRSASH 121

  Fly   109 P 109
            |
  Fly   122 P 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 9/36 (25%)
Cpr72EaNP_648882.1 Chitin_bind_4 48..95 CDD:459790 9/36 (25%)

Return to query results.
Submit another query.