DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp4 and Lcp65Ag2

DIOPT Version :9

Sequence 1:NP_001260804.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_477272.1 Gene:Lcp65Ag2 / 38702 FlyBaseID:FBgn0020637 Length:105 Species:Drosophila melanogaster


Alignment Length:101 Identity:32/101 - (31%)
Similarity:51/101 - (50%) Gaps:10/101 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FKILLVCAL-VALVA-ANENPEVKELVNDVQADGFVSKLVLDNGSAASATGDVHG--------NI 56
            |.|:.|... |||.| |.|.|.:....:||..:.|.......:|.||.|.|.::.        ::
  Fly     3 FLIVFVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTENEAISV 67

  Fly    57 DGVFEWVSPEGEHVRVSYKADENGYQPQSDLLPTPP 92
            .|.:.:::.:|:..:|:|.||:||:|||...||..|
  Fly    68 SGSYRFIADDGQTYQVNYIADKNGFQPQGAHLPVAP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp4NP_001260804.1 Chitin_bind_4 40..81 CDD:278791 12/48 (25%)
Lcp65Ag2NP_477272.1 Chitin_bind_4 37..92 CDD:306811 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.