DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp4 and l(3)mbn

DIOPT Version :10

Sequence 1:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_729143.2 Gene:l(3)mbn / 38701 FlyBaseID:FBgn0002440 Length:653 Species:Drosophila melanogaster


Alignment Length:76 Identity:19/76 - (25%)
Similarity:33/76 - (43%) Gaps:18/76 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VNDVQADGFVSKLVLDNGSAASATGDVH------------------GNIDGVFEWVSPEGEHVRV 72
            :...:|.||..::....|||:|||||::                  |:..|.:..:..:.....:
  Fly   548 ITGTKASGFGGEIGSGRGSASSATGDLYKFKYILDYNGHEETGGRNGDKQGSYFAIGEDAVQRTI 612

  Fly    73 SYKADENGYQP 83
            .|.|:|.|:||
  Fly   613 EYIANEFGFQP 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 13/58 (22%)
l(3)mbnNP_729143.2 Chitin_bind_4 575..621 CDD:459790 5/45 (11%)

Return to query results.
Submit another query.