DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp4 and Cpr49Ah

DIOPT Version :10

Sequence 1:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:99 Identity:37/99 - (37%)
Similarity:49/99 - (49%) Gaps:13/99 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PEVKELVNDVQADGFVSKLVLDNGSAA--SATG---DVHGNIDGV------FEWVSPEGEHVRVS 73
            |.:|  .|..|:|....|...:.|::.  ..||   |...|.:||      :.:.||||..|.|.
  Fly    52 PIIK--YNKEQSDDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQ 114

  Fly    74 YKADENGYQPQSDLLPTPPPIPEAILKAIAYIQA 107
            |.|||||::...|.:||||.|||.|.|.:..|.|
  Fly   115 YTADENGFRATGDHIPTPPAIPEEIQKGLDQIYA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 18/51 (35%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 19/55 (35%)

Return to query results.
Submit another query.