DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp4 and Cpr49Ad

DIOPT Version :9

Sequence 1:NP_001260804.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:136 Identity:30/136 - (22%)
Similarity:46/136 - (33%) Gaps:53/136 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKILLVCALVALVAANE--------NPEVKELV---NDVQ-----ADGFVSK-----------L 38
            :|..|.|..|.|:....:        ||..::|.   .|:.     .|||..|           :
  Fly     5 LFSCLFVLTLAAIACEGQPQYNPYLRNPYYRDLYYRNRDLYNLRRFYDGFYKKYNPYIAAAQARI 69

  Fly    39 VLDNGSAASATGD----------VHG----------------NIDGVFEWVSPEGEHVRVSYKAD 77
            |..|.......|.          :||                .::|.:.:::|||..|.|.|.||
  Fly    70 VEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVEGAYSFITPEGLRVGVKYLAD 134

  Fly    78 ENGYQP 83
            .||::|
  Fly   135 ANGFRP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp4NP_001260804.1 Chitin_bind_4 40..81 CDD:278791 14/66 (21%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:278791 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439239
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.