DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp4 and Cpr49Ad

DIOPT Version :10

Sequence 1:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:136 Identity:30/136 - (22%)
Similarity:46/136 - (33%) Gaps:53/136 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKILLVCALVALVAANE--------NPEVKELV---NDVQ-----ADGFVSK-----------L 38
            :|..|.|..|.|:....:        ||..::|.   .|:.     .|||..|           :
  Fly     5 LFSCLFVLTLAAIACEGQPQYNPYLRNPYYRDLYYRNRDLYNLRRFYDGFYKKYNPYIAAAQARI 69

  Fly    39 VLDNGSAASATGD----------VHG----------------NIDGVFEWVSPEGEHVRVSYKAD 77
            |..|.......|.          :||                .::|.:.:::|||..|.|.|.||
  Fly    70 VEQNNDVNYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVEGAYSFITPEGLRVGVKYLAD 134

  Fly    78 ENGYQP 83
            .||::|
  Fly   135 ANGFRP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 14/66 (21%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:459790 12/54 (22%)

Return to query results.
Submit another query.