DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp4 and Cpr49Ac

DIOPT Version :10

Sequence 1:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster


Alignment Length:58 Identity:20/58 - (34%)
Similarity:36/58 - (62%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 TGDVHGNIDGVFEWVSPEGEHVRVSYKADENGYQPQSDLLPTPPPIPEAILKAIAYIQ 106
            ||..|..  |.:|:...:|:..||:|.:::.|:.||.|.:   .|||:||::|:.|::
  Fly   196 TGGTHAK--GFYEYTGDDGKLYRVNYASNDGGFMPQGDHI---HPIPDAIVRALKYVE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 9/31 (29%)
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:459790 9/31 (29%)

Return to query results.
Submit another query.