DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp4 and Cpr47Eb

DIOPT Version :10

Sequence 1:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_610655.1 Gene:Cpr47Eb / 36189 FlyBaseID:FBgn0033598 Length:214 Species:Drosophila melanogaster


Alignment Length:117 Identity:28/117 - (23%)
Similarity:48/117 - (41%) Gaps:34/117 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKILLVCALVALVA---------ANENPEVKELV------NDVQADGFV-------------SK 37
            |||| .:| |:|||.         .:...|.:|:|      .:...||..             .:
  Fly     1 MFKI-AIC-LLALVGGSLAASIGQVDSTTEKREIVPLLRFETNKNPDGSFHFSYEGGDQSVRQEQ 63

  Fly    38 LVLDNGSAASATGDVHGNIDGVFEWVSPEGEHVRVSYKADENGYQPQSDLLP 89
            .|::|    :.|.|....:.|::.::..:|..|.|.|.|.:||:.|...::|
  Fly    64 GVIEN----AGTEDEALEVSGMYSYIDADGNTVEVHYTAGKNGFVPIGTIIP 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 10/40 (25%)
Cpr47EbNP_610655.1 Chitin_bind_4 48..103 CDD:459790 11/58 (19%)
rne <103..211 CDD:236766 2/9 (22%)

Return to query results.
Submit another query.