DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp4 and Lcp3

DIOPT Version :9

Sequence 1:NP_001260804.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001260803.1 Gene:Lcp3 / 35819 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster


Alignment Length:111 Identity:98/111 - (88%)
Similarity:105/111 - (94%) Gaps:0/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKILLVCALVALVAANENPEVKELVNDVQADGFVSKLVLDNGSAASATGDVHGNIDGVFEWVSP 65
            ||||||||:|.||||||.|.||||||||||.||||||||||:|||:|||||:||||||||||:||
  Fly     1 MFKILLVCSLAALVAANANVEVKELVNDVQPDGFVSKLVLDDGSASSATGDIHGNIDGVFEWISP 65

  Fly    66 EGEHVRVSYKADENGYQPQSDLLPTPPPIPEAILKAIAYIQAHPSK 111
            ||.|||||||||||||||||||||||||||.|||||||||:|:|||
  Fly    66 EGVHVRVSYKADENGYQPQSDLLPTPPPIPAAILKAIAYIEANPSK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp4NP_001260804.1 Chitin_bind_4 40..81 CDD:278791 35/40 (88%)
Lcp3NP_001260803.1 Chitin_bind_4 40..81 CDD:278791 35/40 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470154
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D966
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 1 1.000 - - FOG0014369
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.