DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp4 and LOC1279293

DIOPT Version :10

Sequence 1:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster
Sequence 2:XP_318993.5 Gene:LOC1279293 / 1279293 VectorBaseID:AGAMI1_010278 Length:582 Species:Anopheles gambiae


Alignment Length:107 Identity:45/107 - (42%)
Similarity:59/107 - (55%) Gaps:10/107 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLVCALVALVAANENPEVKELVNDVQADG-FVSKLVLDNGSAASATGDVHGNI--------DGVF 60
            :||.||:|.|||:::..|.....:|..|| :.......||..|...|.:. |:        .|.:
Mosquito   193 VLVIALIATVAADKDATVLRQDAEVNPDGTYQYAYETSNGIVAEEQGTLK-NLGEEQAQVAQGQY 256

  Fly    61 EWVSPEGEHVRVSYKADENGYQPQSDLLPTPPPIPEAILKAI 102
            .:..|||..|.|.|.|||||:|||.|.|||||||||||.:|:
Mosquito   257 SYTDPEGNRVSVQYIADENGFQPQGDHLPTPPPIPEAIERAL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 16/48 (33%)
LOC1279293XP_318993.5 None

Return to query results.
Submit another query.