DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp3 and Cpr47Ea

DIOPT Version :9

Sequence 1:NP_001260803.1 Gene:Lcp3 / 35819 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:116 Identity:31/116 - (26%)
Similarity:52/116 - (44%) Gaps:22/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILLVCSLAALVAA-------------NANVEVKELVNDVQPDG-FVSKLVLDDGSASSATG---- 50
            :|.:|.|:.:.|.             :||..:.:...|:.||| :.......:|..:...|    
  Fly    12 VLALCCLSFIQAQPQRGLPPPRGNSFDANAVILKQNFDLNPDGSYQYNYETSNGIRADEAGYLKN 76

  Fly    51 ---DIHGNI-DGVFEWISPEGVHVRVSYKADENGYQPQSDLLPTPPPIPAA 97
               .|...: .|.:.:..|:||...::|.||||||:.:...:|||||:.||
  Fly    77 PGSQIEAQVMQGSYSYTGPDGVVYTITYIADENGYRAEGAHIPTPPPVRAA 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp3NP_001260803.1 Chitin_bind_4 40..81 CDD:278791 12/48 (25%)
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439198
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.