DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp3 and CG15754

DIOPT Version :10

Sequence 1:NP_476621.1 Gene:Lcp3 / 35819 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster


Alignment Length:106 Identity:26/106 - (24%)
Similarity:35/106 - (33%) Gaps:45/106 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QPDGFVSKLVLDDGSASSATGDIHG--------NIDG--VFEWISPEGV------------HVRV 72
            ||.|.:.:|.  .|.......|.:.        |.||  :|.:..|.|:            |.||
  Fly   162 QPGGVLEELA--GGQVDEELEDYNAWRDNFYELNEDGSYIFGYSIPHGIRRWEKGYYSEEQHGRV 224

  Fly    73 --------------------SYKADENGYQPQS-DLLPTPP 92
                                .|:||..||||:. :.|.|||
  Fly   225 VEGFYVQPRHDSQGLRYELRCYRADSEGYQPRPVEFLRTPP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp3NP_476621.1 Chitin_bind_4 <46..81 CDD:459790 13/76 (17%)
CG15754NP_572894.1 None

Return to query results.
Submit another query.