DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp3 and Cpr60D

DIOPT Version :10

Sequence 1:NP_476621.1 Gene:Lcp3 / 35819 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_726468.1 Gene:Cpr60D / 246492 FlyBaseID:FBgn0050163 Length:93 Species:Drosophila melanogaster


Alignment Length:87 Identity:24/87 - (27%)
Similarity:42/87 - (48%) Gaps:9/87 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKILLVCSLAALVAANANVEVKELVNDVQPDG---FVSKLVLDDGSASSATGDIHGNIDGVFEW 62
            :|.:|..||...|.|     ::.:..|....||   |..::.:.:|....|.|:::| |.|.:..
  Fly    10 LFVVLASCSEEDLQA-----QLLKSENRQNLDGAGQFQHEITVSNGIQVKAQGNVNG-IQGEYFL 68

  Fly    63 ISPEGVHVRVSYKADENGYQPQ 84
            ...:|..:||:|.||..|:.|:
  Fly    69 PGEDGKQIRVTYTADATGFHPK 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp3NP_476621.1 Chitin_bind_4 <46..81 CDD:459790 11/34 (32%)
Cpr60DNP_726468.1 Chitin_bind_4 41..87 CDD:459790 13/46 (28%)

Return to query results.
Submit another query.