DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp3 and Cpr49Aa

DIOPT Version :10

Sequence 1:NP_476621.1 Gene:Lcp3 / 35819 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:70 Identity:35/70 - (50%)
Similarity:47/70 - (67%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DDGSASSATGDIHGNI-DGVFEWISPEGVHVRVSYKADENGYQPQSDLLPTPPPIPAAILKAIAY 104
            ::|...:...|..|.: .|.|.:.||||:.:|::|.|||||:|||.|.||||||||.||.||:||
  Fly    60 EEGYLKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAY 124

  Fly   105 IEANP 109
            :...|
  Fly   125 LATAP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp3NP_476621.1 Chitin_bind_4 <46..81 CDD:459790 14/35 (40%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 15/40 (38%)

Return to query results.
Submit another query.