powered by:
Protein Alignment Lcp3 and Cpr49Aa
DIOPT Version :9
Sequence 1: | NP_001260803.1 |
Gene: | Lcp3 / 35819 |
FlyBaseID: | FBgn0002534 |
Length: | 112 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097285.1 |
Gene: | Cpr49Aa / 246413 |
FlyBaseID: | FBgn0050045 |
Length: | 144 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 35/70 - (50%) |
Similarity: | 47/70 - (67%) |
Gaps: | 1/70 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 DDGSASSATGDIHGNI-DGVFEWISPEGVHVRVSYKADENGYQPQSDLLPTPPPIPAAILKAIAY 104
::|...:...|..|.: .|.|.:.||||:.:|::|.|||||:|||.|.||||||||.||.||:||
Fly 60 EEGYLKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAY 124
Fly 105 IEANP 109
:...|
Fly 125 LATAP 129
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45439310 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1459720at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.950 |
|
Return to query results.
Submit another query.