DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp2 and Cpr65Ax1

DIOPT Version :10

Sequence 1:NP_476620.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster


Alignment Length:111 Identity:23/111 - (20%)
Similarity:40/111 - (36%) Gaps:36/111 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DANM-SMVE-NNYRAALERLEKSR------------------------RAPSLDREVKPRASPFV 51
            |.|| |.|. |.....|:|::.:|                        |.|.:.:.:...... :
  Fly   310 DENMVSFVTLNKVGGFLQRMDLARKYSFGKMLICGSEGPFKVKGLWLFRGPEIPKFIMDEVYD-M 373

  Fly    52 SRYDFNGADLDEELQVARSRASRVIHEKSTIDQRAEQFRSSSLAPA 97
            ..|::...|:.:|.|  :.|.|::|.:       ||.|...:|..|
  Fly   374 ELYEWTKVDISDEAQ--KERVSQMIED-------AEPFEGEALLDA 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp2NP_476620.1 Chitin_bind_4 42..89 CDD:459790 9/46 (20%)
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.