DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp2 and Cpr100A

DIOPT Version :10

Sequence 1:NP_476620.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster


Alignment Length:109 Identity:32/109 - (29%)
Similarity:53/109 - (48%) Gaps:13/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFVMILAVVGVATALAPVSRSDDVHAD-----VLSRSDDVRADG-FDSSLHTSNGIEQAASGD 59
            ||:|:.:..:|.:|:       |...|.|     ::|....:..|| |.::....:||......|
  Fly     1 MFRFLALTTLVALAS-------SQHYHQDPKTAAIISEQRYLSGDGKFGAAYEQEDGINFKEETD 58

  Fly    60 AHGNIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPIP 103
            |.|..||::.::.|.|:...:.|.|.:||:|.||..:|..||.|
  Fly    59 ADGTRHGSYSYLDPTGQRRTISYTAGKNGFQASGDHLPQAPPAP 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp2NP_476620.1 Chitin_bind_4 42..89 CDD:459790 13/46 (28%)
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:459790 12/43 (28%)

Return to query results.
Submit another query.