DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp2 and CG8927

DIOPT Version :10

Sequence 1:NP_476620.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:50 Identity:12/50 - (24%)
Similarity:19/50 - (38%) Gaps:18/50 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GNFGWISPEGEHVEVKYVA---------------NENG---YQPSGAWIP 97
            |.:|::.|:|...|..|..               .|||   |:.:.|.:|
  Fly   298 GTYGYVDPDGNKREYHYETGIKCDPNNRNNEEELQENGFVNYEENRAVLP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp2NP_476620.1 Chitin_bind_4 42..89 CDD:459790 9/40 (23%)
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 8/37 (22%)

Return to query results.
Submit another query.