DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp2 and Ccp84Ae

DIOPT Version :10

Sequence 1:NP_476620.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:158 Identity:37/158 - (23%)
Similarity:58/158 - (36%) Gaps:39/158 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFVMILAVVGVA------TALAPVSRSDDVHADVLSRSDDVRADGFDSSLHTSNGIEQAASGDAH 61
            |.|:.||:..||      || |||:.: .....||:::.::...........|..::...|||..
  Fly     4 KIVIALALFAVAHGAVLRTA-APVAVA-SAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNK 66

  Fly    62 GN--------IHGNFGWISPEGEHVEVKYVANE-NGY------QPSGAWI--------------- 96
            |:        :.|.:..|..:|....|.|.|:. ||:      :|..|.:               
  Fly    67 GHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAEPLLKVAAPLVKA 131

  Fly    97 -PTPPPIPEAIARAVAWLESHPPAPEHP 123
             |..|..|.|:|.....:.|.|.|...|
  Fly   132 APVAPIAPVALAAPAPIVRSAPVAVAAP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp2NP_476620.1 Chitin_bind_4 42..89 CDD:459790 12/55 (22%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 12/51 (24%)

Return to query results.
Submit another query.