DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp2 and Cpr67Fa1

DIOPT Version :9

Sequence 1:NP_001260802.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_648418.1 Gene:Cpr67Fa1 / 39223 FlyBaseID:FBgn0036108 Length:134 Species:Drosophila melanogaster


Alignment Length:118 Identity:46/118 - (38%)
Similarity:74/118 - (62%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFVMILAVVGVATALAPVSRSDDVHADVLSRSDDVRADG-FDSSLHTSNGIEQAASGDAHGNI 64
            ||:::::.:.: :|.|....:.:.:..|.:.....|::.:| ::....|||||....||....:.
  Fly     1 MFRYLLVASAI-LACAYGAATYNQEAGAYITKIGSDIQPEGNYNYQYETSNGIAAQESGIGGNHA 64

  Fly    65 HGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPIPEAIARAVAWLESHP 117
            :|.|.|.|||||.|::.|||:||||||.||.:|||||||.||.|::.::.:||
  Fly    65 NGGFSWYSPEGELVQISYVADENGYQPQGALLPTPPPIPAAILRSLEYIRTHP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp2NP_001260802.1 Chitin_bind_4 42..89 CDD:278791 21/46 (46%)
Cpr67Fa1NP_648418.1 Chitin_bind_4 42..89 CDD:278791 21/46 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470182
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.