DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp2 and Cpr49Ag

DIOPT Version :9

Sequence 1:NP_001260802.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_610776.1 Gene:Cpr49Ag / 36353 FlyBaseID:FBgn0033730 Length:134 Species:Drosophila melanogaster


Alignment Length:138 Identity:40/138 - (28%)
Similarity:61/138 - (44%) Gaps:43/138 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFVMILAVVGVATALA---PVSRSDDVHADVLS-----------RSDDV-RADG-FDSSLHTS 49
            |:|.|.:     |.:||.   .::|..|..|...|           :.|:| .||| |:||..||
  Fly     1 MYKLVFL-----VCSALLLSYVLARPQDQRAGATSAATTTTAATIVKQDNVNNADGSFNSSYETS 60

  Fly    50 NGIE---------------QAASG---DAHGNI----HGNFGWISPEGEHVEVKYVANENGYQPS 92
            |||.               :.:.|   |.|..:    .|::.:..|:|..:.::|||:|||:||.
  Fly    61 NGIRVENIGYLKKIIVPKTETSDGQVIDEHEELVLVQTGSYSYSDPDGNLITLRYVADENGFQPE 125

  Fly    93 GAWIPTPP 100
            |..:|..|
  Fly   126 GDHLPVAP 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp2NP_001260802.1 Chitin_bind_4 42..89 CDD:278791 19/68 (28%)
Cpr49AgNP_610776.1 Chitin_bind_4 53..122 CDD:278791 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.