DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp2 and Cpr47Ef

DIOPT Version :10

Sequence 1:NP_476620.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster


Alignment Length:91 Identity:37/91 - (40%)
Similarity:55/91 - (60%) Gaps:9/91 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VLSRSDDVRADG-FDSSLHTSNGIEQAASGDAHG--------NIHGNFGWISPEGEHVEVKYVAN 85
            :||..::...|| :..|..|.|||:....|....        ::.|::.:.:||||.||:.|.|:
  Fly   136 ILSFVNENDGDGNYRFSYETGNGIKAQEEGTVKNKGSENEIPSVMGSYSYTNPEGELVEIMYTAD 200

  Fly    86 ENGYQPSGAWIPTPPPIPEAIARAVA 111
            |||:.|||..:|||||||||||:::|
  Fly   201 ENGFVPSGNALPTPPPIPEAIAKSLA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp2NP_476620.1 Chitin_bind_4 42..89 CDD:459790 17/54 (31%)
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:459790 17/54 (31%)

Return to query results.
Submit another query.