DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp2 and Lcp3

DIOPT Version :9

Sequence 1:NP_001260802.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001260803.1 Gene:Lcp3 / 35819 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster


Alignment Length:117 Identity:54/117 - (46%)
Similarity:74/117 - (63%) Gaps:8/117 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFVMILAVVGVATALAPVSRSDDVHADVLSRSDDVRADGFDSSLHTSNGIEQAASGDAHGNIH 65
            |||.:::.::..:..|.|.|        :|....:||:.|||.|.|...:|...:|:||.||||.
  Fly     1 MFKILLVCSLAALVAANANV--------EVKELVNDVQPDGFVSKLVLDDGSASSATGDIHGNID 57

  Fly    66 GNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPIPEAIARAVAWLESHP 117
            |.|.||||||.||.|.|.|:||||||....:|||||||.||.:|:|::|::|
  Fly    58 GVFEWISPEGVHVRVSYKADENGYQPQSDLLPTPPPIPAAILKAIAYIEANP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp2NP_001260802.1 Chitin_bind_4 42..89 CDD:278791 26/46 (57%)
Lcp3NP_001260803.1 Chitin_bind_4 40..81 CDD:278791 23/40 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014369
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.