DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp2 and LOC1270062

DIOPT Version :10

Sequence 1:NP_476620.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_001688064.1 Gene:LOC1270062 / 1270062 VectorBaseID:AGAMI1_011311 Length:150 Species:Anopheles gambiae


Alignment Length:31 Identity:5/31 - (16%)
Similarity:18/31 - (58%) Gaps:3/31 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSARRGLRTRVYDANMSMVE---NNYRAALE 28
            ::|.|.:|..:...::.:::   :||..:::
Mosquito   165 LNANRNIRRMMGTHHLQVLQDKGHNYVTSMQ 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp2NP_476620.1 Chitin_bind_4 42..89 CDD:459790
LOC1270062XP_001688064.1 Chitin_bind_4 52..99 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.