DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp1 and Lcp65Af

DIOPT Version :10

Sequence 1:NP_476619.1 Gene:Lcp1 / 35817 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster


Alignment Length:113 Identity:32/113 - (28%)
Similarity:52/113 - (46%) Gaps:23/113 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFVMI-CAVLGLAVANPPVPHSLGRSEDVHADVLSQSDDVRADGFDSSLHTSNGIEQAASGDAHG 66
            ||::: .|:..||||:              ..:|.|..||....|:....||:|....|:|....
  Fly     2 KFLIVFVALFALAVAD--------------VQILKQESDVGPVSFNYGYETSDGSSAQAAGQLKN 52

  Fly    67 --------NIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPI 106
                    |:.|.:.:::.:|:...:.|.|:||||||.||.:|..|.:
  Fly    53 VGTDEEALNVKGTYSFVADDGQTYSIAYTADENGYQPQGAHLPVAPVV 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp1NP_476619.1 Chitin_bind_4 46..93 CDD:459790 13/54 (24%)
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 13/54 (24%)

Return to query results.
Submit another query.