DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp1 and Edg78E

DIOPT Version :9

Sequence 1:NP_001260801.1 Gene:Lcp1 / 35817 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster


Alignment Length:125 Identity:45/125 - (36%)
Similarity:76/125 - (60%) Gaps:10/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFVMICAVLGLAVANPPVPHSLGRSEDVHADVLSQSDDVRADG-FDSSLHTSNGIEQAASGDA 64
            |:|::...|::|.|.|:     ::.:...:.:   .|:|...|:| :..:..|||||:...:|:|
  Fly     1 MYKYLFCLALIGCACAD-----NINKDAQIRS---FQNDATDAEGNYQYAYETSNGIQIQEAGNA 57

  Fly    65 HGNIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPIPEAIARAVAWLESHPPAP 124
            :| ..|...::||||||:.:.|.|:|.||.|.|..:|||||:|..:.||:.::.:|||||
  Fly    58 NG-ARGAVAYVSPEGEHISLTYTADEEGYHPVGDHLPTPPPVPAYVLRALEYIRTHPPAP 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp1NP_001260801.1 Chitin_bind_4 46..93 CDD:278791 18/46 (39%)
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 18/46 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470207
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.