DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp1 and Cpr78Ca

DIOPT Version :9

Sequence 1:NP_001260801.1 Gene:Lcp1 / 35817 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:80 Identity:30/80 - (37%)
Similarity:45/80 - (56%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FDSSLHTSNGIEQAASGDAHGNIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPIPEAI 110
            :.....|:|||....:|:.:|.: |...::||||..|...|||:.|||||:|..||.   ||..:
  Fly    46 YSFEFQTTNGITTKGAGNENGAV-GVVQFVSPEGIPVTFSYVADANGYQPTGDHIPA---IPLHV 106

  Fly   111 ARAVAWLESHPPAPE 125
            .|.:.::.:|||..|
  Fly   107 IRQLEYIRTHPPVDE 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp1NP_001260801.1 Chitin_bind_4 46..93 CDD:278791 16/46 (35%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:278791 16/46 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.