powered by:
Protein Alignment Lcp1 and Cpr65Aw
DIOPT Version :9
Sequence 1: | NP_001260801.1 |
Gene: | Lcp1 / 35817 |
FlyBaseID: | FBgn0002531 |
Length: | 130 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_729147.1 |
Gene: | Cpr65Aw / 38706 |
FlyBaseID: | FBgn0052404 |
Length: | 117 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 24/72 - (33%) |
Similarity: | 42/72 - (58%) |
Gaps: | 8/72 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 SDDVRADGFDSSLHTSNGI--EQAASGDAHGN------IHGNFGWISPEGEHVEVKYVANENGYQ 94
::::.:||:..|..||:|| |:.|:....|. |.|:..|:.|:|.|.::.|:|:|||:|
Fly 33 NENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLADENGFQ 97
Fly 95 PSGAWIP 101
..|..:|
Fly 98 AQGEHLP 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45439227 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.