DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp1 and Cpr49Af

DIOPT Version :9

Sequence 1:NP_001260801.1 Gene:Lcp1 / 35817 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001286347.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:133 Identity:37/133 - (27%)
Similarity:69/133 - (51%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFVMICAVLGLAVANPPVPHSLGRSEDVHADVLSQSDDVRADG--------FDSSLHTSNGIEQA 59
            |::|:.|:..:|.           |...:.|.:||..:|..:|        .|.|..|.:|:.::
  Fly     2 KYLMLIALFVVAA-----------SATDNDDPISQESNVEYNGKYHYHYELKDGSKATQDGVLKS 55

  Fly    60 ASGDAHG-NIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPIPEAIARAVAWLESHP-P 122
            .:.|.:| :::|.:.:::.:|:...|.|.|:||||...|..:|||||.|.::.:|:.::..|| .
  Fly    56 VNADHNGESVNGKYSFVADDGKTYVVSYTADENGYLAVGDHLPTPPPTPVSVLKALEYIRLHPYK 120

  Fly   123 APE 125
            .||
  Fly   121 TPE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp1NP_001260801.1 Chitin_bind_4 46..93 CDD:278791 13/47 (28%)
Cpr49AfNP_001286347.1 Chitin_bind_4 35..90 CDD:278791 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.