DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp1 and Lcp4

DIOPT Version :9

Sequence 1:NP_001260801.1 Gene:Lcp1 / 35817 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001260804.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster


Alignment Length:121 Identity:59/121 - (48%)
Similarity:79/121 - (65%) Gaps:12/121 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFVMICAVLGLAVANPPVPHSLGRSEDVHADVLSQSDDVRADGFDSSLHTSNGIEQAASGDAH 65
            |||.:::||::.|..||.            :.:|....:||:||||.|.|...||...:|:||.|
  Fly     1 MFKILLVCALVALVAANE------------NPEVKELVNDVQADGFVSKLVLDNGSAASATGDVH 53

  Fly    66 GNIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPIPEAIARAVAWLESHP 121
            |||.|.|.|:|||||||.|.|.|:||||||....:||||||||||.:|:|::::||
  Fly    54 GNIDGVFEWVSPEGEHVRVSYKADENGYQPQSDLLPTPPPIPEAILKAIAYIQAHP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp1NP_001260801.1 Chitin_bind_4 46..93 CDD:278791 27/46 (59%)
Lcp4NP_001260804.1 Chitin_bind_4 40..81 CDD:278791 24/40 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470158
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D966
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014369
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.