DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN7 and FUS5

DIOPT Version :9

Sequence 1:NP_610379.2 Gene:CSN7 / 35816 FlyBaseID:FBgn0028836 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_563645.1 Gene:FUS5 / 839241 AraportID:AT1G02090 Length:260 Species:Arabidopsis thaliana


Alignment Length:244 Identity:87/244 - (35%)
Similarity:140/244 - (57%) Gaps:7/244 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AKSSTGAALLDVIRQALEAPNVFVFGELLAEPSVLQLKDGPDSKHFETLNLFAYGTYKEYRAQPE 91
            |.:....||..:|.:|...|::|.|.|:||.|:|.||:...||.:.:.|.|||:||:.:|:....
plant    18 ASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNAT 82

  Fly    92 KFIELTPAMQKKLQHLTIVSLAIKAKSIPYALLLSELEIDNVRHLEDIII-EAIYADIIHGKLFQ 155
            :...|:|....||:.||:::||...|.:||..|:.||::.|||.|||.:| |.:||.|:.|||.|
plant    83 RLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQ 147

  Fly   156 NTRILEVDYAQGRDIPPGYTGQIVETLQAWVNSCDSVSNCIEMQIKYAN--AEKSKRLINKERVE 218
            ..|..||.:|.|||:.||..|.::.||..|:|:.:::...|:.:||:|:  :|..|:  :::..|
plant   148 LKRCFEVPFAAGRDLRPGQLGNMLHTLSNWLNTSENLLISIQDKIKWADNMSEMDKK--HRKEAE 210

  Fly   219 QDLINLKKVLKSQTSDSDESMQIDTHGPGTSGGLGQSELRKKPSKLRNP 267
            :.:..:||.| |...|.|.....:..|. .||.:...|...:|.:.|:|
plant   211 EGVEEVKKSL-SMKGDVDIRGNKEMFGE-PSGVMDYEEDGIRPKRRRHP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN7NP_610379.2 PAM 96..185 CDD:214803 41/89 (46%)
FUS5NP_563645.1 PINT 86..177 CDD:214509 41/90 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3250
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8068
Inparanoid 1 1.050 139 1.000 Inparanoid score I1801
OMA 1 1.010 - - QHG55460
OrthoDB 1 1.010 - - D1396757at2759
OrthoFinder 1 1.000 - - FOG0003991
OrthoInspector 1 1.000 - - oto2958
orthoMCL 1 0.900 - - OOG6_102373
Panther 1 1.100 - - LDO PTHR15350
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3281
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.