DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN7 and eIF3m

DIOPT Version :9

Sequence 1:NP_610379.2 Gene:CSN7 / 35816 FlyBaseID:FBgn0028836 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001286407.1 Gene:eIF3m / 36565 FlyBaseID:FBgn0033902 Length:387 Species:Drosophila melanogaster


Alignment Length:195 Identity:44/195 - (22%)
Similarity:82/195 - (42%) Gaps:20/195 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CVLAKSSTGAALLDVIRQALEAPNVFVFGELLAEPSVLQLKDGPDSKHFETLNLFA---YGTYKE 85
            ||..:.:     :..|..||..||.|:...||:...|..|:.  |..| :.|::|.   ...|.:
  Fly   199 CVAREDA-----MKCIVTALADPNTFLLDPLLSLKPVRFLEG--DLIH-DLLSIFVSEKLPAYVQ 255

  Fly    86 YRAQPEKFIELT----PAMQKKLQHLTIVSLAIKAKSIPYALLLSELEIDNVRHLEDIIIEAIYA 146
            :.....:|:...    ....||::.||.:.||..:..:.:..|..||:| |...:|..:||.:..
  Fly   256 FYEDHREFVNSQGLNHEQNMKKMRLLTFMQLAESSPEMTFETLTKELQI-NEDEVEPFVIEVLKT 319

  Fly   147 DIIHGKLFQNTRILEVDYAQGRDIPPGYTGQIVETLQAWVNSCDSV----SNCIEMQIKYANAEK 207
            .::..:|.|..:.:.:.....|........|:.:.||||..:..:|    ::....|:..|.::|
  Fly   320 KLVRARLDQANQKVHISSTMHRTFGAPQWEQLRDLLQAWKENLSTVREGLTSVSSAQLDLARSQK 384

  Fly   208  207
              Fly   385  384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN7NP_610379.2 PAM 96..185 CDD:214803 20/92 (22%)
eIF3mNP_001286407.1 PCI 236..336 CDD:396121 22/101 (22%)
eIF3m_C_helix 341..369 CDD:407846 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15350
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.