DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN7 and Cops7b

DIOPT Version :9

Sequence 1:NP_610379.2 Gene:CSN7 / 35816 FlyBaseID:FBgn0028836 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001102277.1 Gene:Cops7b / 363273 RGDID:1306918 Length:322 Species:Rattus norvegicus


Alignment Length:265 Identity:117/265 - (44%)
Similarity:167/265 - (63%) Gaps:4/265 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TQDM-LLGNEEPSKSKETFLEKFCVLAKSSTGAALLDVIRQALEAPNVFVFGELLAEPSVLQLKD 65
            :||. :.|.::||.:   .||:|.:|||.::|:||..:|.|.||||.|:||||||...:|.:|.:
  Rat    54 SQDQRMAGEQKPSSN---LLEQFILLAKGTSGSALTTLISQVLEAPGVYVFGELLELANVQELAE 115

  Fly    66 GPDSKHFETLNLFAYGTYKEYRAQPEKFIELTPAMQKKLQHLTIVSLAIKAKSIPYALLLSELEI 130
            |.::.:.:.|||||||||.:|.|..|...||:.|.|.||:||||||||.:.|.|||::||.:||:
  Rat   116 GANAAYLQLLNLFAYGTYPDYIANKESLPELSAAQQNKLKHLTIVSLASRMKCIPYSVLLKDLEM 180

  Fly   131 DNVRHLEDIIIEAIYADIIHGKLFQNTRILEVDYAQGRDIPPGYTGQIVETLQAWVNSCDSVSNC 195
            .|:|.|||:||||:|.|||.|||.|..::||||:..||||.......||:||..|.:.|::|...
  Rat   181 RNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIGRDIQKKDINNIVKTLHEWCDGCEAVLLG 245

  Fly   196 IEMQIKYANAEKSKRLINKERVEQDLINLKKVLKSQTSDSDESMQIDTHGPGTSGGLGQSELRKK 260
            ||.|:..||..|......:::||.::.|:||.||:..|.|.:.|:.............|.:..||
  Rat   246 IEQQVLRANQYKENHHRTQQQVEAEVSNIKKTLKATASSSAQEMEQQLAERECPPHTEQRQPTKK 310

  Fly   261 PSKLR 265
            .||::
  Rat   311 MSKVK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN7NP_610379.2 PAM 96..185 CDD:214803 50/88 (57%)
Cops7bNP_001102277.1 PAM 146..235 CDD:214803 50/88 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339763
Domainoid 1 1.000 86 1.000 Domainoid score I7901
eggNOG 1 0.900 - - E1_KOG3250
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8068
Inparanoid 1 1.050 209 1.000 Inparanoid score I3601
OMA 1 1.010 - - QHG55460
OrthoDB 1 1.010 - - D1396757at2759
OrthoFinder 1 1.000 - - FOG0003991
OrthoInspector 1 1.000 - - otm45310
orthoMCL 1 0.900 - - OOG6_102373
Panther 1 1.100 - - LDO PTHR15350
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.