DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN7 and cops7a

DIOPT Version :9

Sequence 1:NP_610379.2 Gene:CSN7 / 35816 FlyBaseID:FBgn0028836 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001292525.1 Gene:cops7a / 336736 ZFINID:ZDB-GENE-030131-8680 Length:268 Species:Danio rerio


Alignment Length:254 Identity:105/254 - (41%)
Similarity:155/254 - (61%) Gaps:12/254 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SSTGAALLDVIRQALEAPNVFVFGELLAEPSVLQLKDGPDSKHFETLNLFAYGTYKEYRAQPEKF 93
            |.:|:||...|...||.|.::||.::|..|:|.:|:.||.:..::.|||||||||.:|:.:....
Zfish     8 SLSGSALAQAISSILETPGLYVFSDILELPNVRELETGPHAPVYQLLNLFAYGTYCDYKERTASL 72

  Fly    94 IELTPAMQKKLQHLTIVSLAIKAKSIPYALLLSELEIDNVRHLEDIIIEAIYADIIHGKLFQNTR 158
            .|||||.:.||:||:|:|||...|.:||:|||.:||:.|||.|||::|||||:|||||||.|..:
Zfish    73 PELTPAQRNKLRHLSIISLASNLKCLPYSLLLQQLELKNVRELEDLLIEAIYSDIIHGKLDQRNQ 137

  Fly   159 ILEVDYAQGRDIPPGYTGQIVETLQAWVNSCDSVSNCIEMQIKYANAEKSKRLINKERVEQDLIN 223
            .:|||.:.|||:.|.....|..|||.|...|::|...||.|:..||..:..:|..|.:||.::.|
Zfish   138 QVEVDCSIGRDLGPNELPNIANTLQEWCAGCEAVLCGIEEQVSRANQYRESQLKVKVQVETEVSN 202

  Fly   224 LKKVLKSQTSDSDESMQIDTHGPGTSGGLGQSELRKKPSKLRNPRSA----AVGLKFSK 278
            |:|.||:.::.       .:.||..:|.....: ..:|::.|:|.|:    ..|.|.||
Zfish   203 LQKTLKASSAS-------PSSGPAPAGAASNQD-ADQPAEPRDPASSQEPRQPGKKSSK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN7NP_610379.2 PAM 96..185 CDD:214803 50/88 (57%)
cops7aNP_001292525.1 PAM 75..164 CDD:214803 50/88 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579555
Domainoid 1 1.000 88 1.000 Domainoid score I7923
eggNOG 1 0.900 - - E1_KOG3250
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I3901
OMA 1 1.010 - - QHG55460
OrthoDB 1 1.010 - - D1396757at2759
OrthoFinder 1 1.000 - - FOG0003991
OrthoInspector 1 1.000 - - oto38985
orthoMCL 1 0.900 - - OOG6_102373
Panther 1 1.100 - - O PTHR15350
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3281
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.