DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN7 and Cops7a

DIOPT Version :9

Sequence 1:NP_610379.2 Gene:CSN7 / 35816 FlyBaseID:FBgn0028836 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_006506224.2 Gene:Cops7a / 26894 MGIID:1349400 Length:380 Species:Mus musculus


Alignment Length:260 Identity:113/260 - (43%)
Similarity:157/260 - (60%) Gaps:13/260 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EKFCVLAKSSTGAALLDVIRQALEAPNVFVFGELLAEPSVLQLKDGPDSKHFETLNLFAYGTYKE 85
            |:|.:||||:.||||..:|.|.||||.|:||||||..|:|.:|.:...:..|..|.:||||||.:
Mouse   116 EQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYAD 180

  Fly    86 YRAQPEKFIELTPAMQKKLQHLTIVSLAIKAKSIPYALLLSELEIDNVRHLEDIIIEAIYADIIH 150
            |.|:......||.|.:.||:||::|:||.|.|.||||:||..|.:.|||.|||::|||:|||::.
Mouse   181 YLAEARNLPPLTDAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLR 245

  Fly   151 GKLFQNTRILEVDYAQGRDIPPGYTGQIVETLQAWVNSCDSVSNCIEMQIKYANAEKSKRLINKE 215
            |.|.|..:.|||||:.||||.......|.:|||.|...|:.|.:.||.|:..||..|.::|..|:
Mouse   246 GSLDQRNQRLEVDYSIGRDIQRQDLSAIAQTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQ 310

  Fly   216 RVEQDLINLKKVLK-------SQTSDSDESMQIDTHGPGTSGGLGQSELRKKPSKLR----NPRS 269
            ::|.::.||||.:|       :.||...|....:...|  :.|..|.:..||.||.:    ||:|
Mouse   311 QIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREP--ASGTNQRQPSKKASKGKGEKINPQS 373

  Fly   270  269
            Mouse   374  373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN7NP_610379.2 PAM 96..185 CDD:214803 47/88 (53%)
Cops7aXP_006506224.2 PINT 190..280 CDD:214509 47/89 (53%)
CSN7a_helixI 269..318 CDD:408191 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836099
Domainoid 1 1.000 86 1.000 Domainoid score I8099
eggNOG 1 0.900 - - E1_KOG3250
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 208 1.000 Inparanoid score I3681
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55460
OrthoDB 1 1.010 - - D1396757at2759
OrthoFinder 1 1.000 - - FOG0003991
OrthoInspector 1 1.000 - - otm43238
orthoMCL 1 0.900 - - OOG6_102373
Panther 1 1.100 - - O PTHR15350
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R257
SonicParanoid 1 1.000 - - X3281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.