DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN7 and csn71

DIOPT Version :9

Sequence 1:NP_610379.2 Gene:CSN7 / 35816 FlyBaseID:FBgn0028836 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_594814.1 Gene:csn71 / 2542127 PomBaseID:SPAC1952.12c Length:205 Species:Schizosaccharomyces pombe


Alignment Length:212 Identity:52/212 - (24%)
Similarity:90/212 - (42%) Gaps:31/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IRQALEAPNVFVFGELLAEPSVLQLKDGPDSKHFETLNLFAYGTYKEYRAQPEKFIELTPAMQKK 103
            |.||::.||||.|.||..|...:|.....||....||.:|..|..::..:      |......||
pombe     5 ISQAIDDPNVFCFQELWIECQEVQKSQPIDSAVLRTLEIFCRGDIRDASS------EWNELRFKK 63

  Fly   104 LQHLTIVSLAIK--AKSIPYALLLSELEIDNVR------HLEDIIIEAIYADIIHGKLFQNTRIL 160
            |:.||::.||.:  ..|:.:..:|..|::|.:.      .:|..|::|:...|:.||:...|:.|
pombe    64 LRLLTLIDLANRHVGSSVSFETILVHLQLDRLPPSDPTFTVEYYIMQAMMNQILVGKINAKTQTL 128

  Fly   161 EVDYAQGRDIPPGYTGQIVETLQAWVNSCDSVSNCIEMQIKYANAEKSKRLINKERVEQDLINLK 225
            .|.:|..|.:......::..:|..::..|.:    |..|:.......||             :.|
pombe   129 HVSWALERFLDSKRIDEMKYSLDRFIERCSN----ILFQLDAGTPSVSK-------------SFK 176

  Fly   226 KVLKSQTSDSDESMQID 242
            :..:..:||..:.|..|
pombe   177 RASRMSSSDGIDYMVFD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN7NP_610379.2 PAM 96..185 CDD:214803 23/96 (24%)
csn71NP_594814.1 PCI 56..151 CDD:295179 22/94 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3250
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I2036
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003991
OrthoInspector 1 1.000 - - oto101123
orthoMCL 1 0.900 - - OOG6_102373
Panther 1 1.100 - - LDO PTHR15350
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R257
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.