DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2121 and SPAC6F6.04c

DIOPT Version :9

Sequence 1:NP_001137618.1 Gene:CG2121 / 35814 FlyBaseID:FBgn0033289 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_593897.1 Gene:SPAC6F6.04c / 2542743 PomBaseID:SPAC6F6.04c Length:489 Species:Schizosaccharomyces pombe


Alignment Length:262 Identity:62/262 - (23%)
Similarity:105/262 - (40%) Gaps:56/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 CPGV-------GA-EANPNLVPPAPEQIQLLNSIFLTC-MAAAVVMMIFGVSSLKRYGVKRGDTG 327
            |||:       || ..:|:....|.....||.::|..| .|...::...|    .|:.:..|.||
pombe    38 CPGIYLAVTGLGAGGGHPDAYHMADVTNSLLYALFTVCGWAGGPILKYLG----PRWALALGATG 98

  Fly   328 -------------DGMSGLKLLTVTINLLRKRRQILMLPITMFIGLEEAFLAVDFTRSFVACGWG 379
                         .|..|..:.|.....:...   |:...|.:|.|  ::...:....|:|..|.
pombe    99 YPIYIGGLWYFDNTGKQGFTIFTGAYEGIAAG---LLWASTAYISL--SYSCANQKSQFIATQWT 158

  Fly   380 I----SRIGFAMICFGV-ANAVAAGIAGALVERIGRVTLAALCAVVNLCLLTYMYTWEAREGDYM 439
            |    |.:| :.|.||: .::.:.|:..| |..|..:.:|  |||: |.:|......:.|:.|..
pombe   159 ILAFGSTVG-SFIAFGINYHSTSTGVPMA-VYIIFIIIMA--CAVL-LAILFIKSPSDVRKSDGT 218

  Fly   440 SYC-----TFA-AVWGICDGV--W--LVVVNAFYG----ILFPNHLIAAYSNFRLWESTGSVIGY 490
            |..     ||. .:||:.:..  |  |.::.|.:.    |.:.:||.:.|.:.|. .|..:|:.:
pombe   219 SALSPSNKTFGQELWGLFEAAKDWRLLCLLPASFASQSTIAWQSHLNSYYFSLRT-RSLNNVLFW 282

  Fly   491 VI 492
            ||
pombe   283 VI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2121NP_001137618.1 MFS 84..>189 CDD:304372
MFS_1 <296..476 CDD:284993 47/212 (22%)
SPAC6F6.04cNP_593897.1 MFS <54..183 CDD:304372 28/138 (20%)
MFS_1 56..403 CDD:284993 56/244 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.