DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm3 and acj6

DIOPT Version :9

Sequence 1:NP_001188885.2 Gene:pdm3 / 35813 FlyBaseID:FBgn0261588 Length:1292 Species:Drosophila melanogaster
Sequence 2:NP_524876.1 Gene:acj6 / 47080 FlyBaseID:FBgn0000028 Length:396 Species:Drosophila melanogaster


Alignment Length:262 Identity:73/262 - (27%)
Similarity:121/262 - (46%) Gaps:53/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1056 TSSVSHMQPLKLSPSSRSEPPHLSPNGNDNDNDLLMDSPNEPTIN-------------------- 1100
            |.|::.:.|:..||.:   |.|...:|:.:..:.:|...:..|::                    
  Fly   152 TGSMTTLAPISESPLT---PTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAA 213

  Fly  1101 QATTNVVDGIDLD--EIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGP---AYSQSAICSSALAA 1160
            .|...:....|.|  |::.||:.||.||:.||:||..||:||:..:.|   |.|||.||      
  Fly   214 VAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTIC------ 272

  Fly  1161 QMYAAQLSTQQQNMFEKLDITPKSAQKIKPVLERWMKEAEESHWNRYKSGQNHLTDYIGVEPS-K 1224
                         .||.|.::..:...:||:|:.|::|||....|:.:.     .|...|.|: :
  Fly   273 -------------RFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRD-----PDAPSVLPAGE 319

  Fly  1225 KRKRRTSFTPQALELLNAHFERNTHPSGTEITGLAHQLGYEREVIRIWFCNKRQALKNTVRMMSK 1289
            |:::|||........|.|:|.....|||.:|..:|.:|..::.|:|:||||:||..|..|..::.
  Fly   320 KKRKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTP 384

  Fly  1290 GM 1291
            .|
  Fly   385 SM 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm3NP_001188885.2 Pou 1108..1200 CDD:304656 32/96 (33%)
Homeobox 1228..1281 CDD:278475 20/52 (38%)
acj6NP_524876.1 POU 222..299 CDD:197673 32/95 (34%)
Homeobox 323..377 CDD:395001 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.