DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm3 and Cchcr1

DIOPT Version :9

Sequence 1:NP_001188885.2 Gene:pdm3 / 35813 FlyBaseID:FBgn0261588 Length:1292 Species:Drosophila melanogaster
Sequence 2:NP_001002822.2 Gene:Cchcr1 / 406196 RGDID:1302992 Length:869 Species:Rattus norvegicus


Alignment Length:334 Identity:84/334 - (25%)
Similarity:136/334 - (40%) Gaps:64/334 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 LSASSLANVLAAATASPPPSLQAPP---ASAQMPQL----------ILASGQLVQGVQGAQLLIP 590
            |.|..||.|.....:.|||....||   .|.::.||          :..|..|:|...|.    .
  Rat   560 LMARKLALVQLRLESCPPPEPAPPPDTDLSLELEQLREERNRLDAELQLSAHLIQQEVGR----V 620

  Fly   591 TAQGIAVQTILTIPVSPQIPTTEQFLPNAFGAFASYQQQ-------QQQQQQQRDLLPPSLAALQ 648
            ..||.|....|| .|:.|:   ||.|..|..:.||..||       ||:..::...|...|...|
  Rat   621 REQGEAEHRHLT-EVAQQL---EQELQRAQESLASVGQQLEAARQGQQESTEEAASLRQELTQQQ 681

  Fly   649 --HATALPQLAQTPTNLLKPNLFSTGVQQLLTALHPELFAAAA-------ATHQQQQQQQQQQVQ 704
              :..||.:......:.|:..|..| .::|..|...:..|..:       ||.::::.|:.:::|
  Rat   682 EIYGQALQEKVAEVESRLREQLSDT-KRRLNEARREQAKAVVSLRQIQHKATLEKERNQELRRLQ 745

  Fly   705 QQREREREREREREREREREREQHLGIGHLPHSHLAADLRRSAERSPTAGSPTGGSPGLAAKGPQ 769
            .:..:| |.:|...|.:|.||:::|.:..|....|   |.|..::...|..|:|.|...:::..:
  Rat   746 DEARKE-EGQRLTRRVQELERDKNLMLATLKQEGL---LSRYKQQRLLAVLPSGVSKKCSSQPVE 806

  Fly   770 PPPPGAAFLLQQQLHIKPETQTHLHHHLQTQSTSAVSSTLPQISLRHPDELTAPQMDLKPLELSA 834
            ||...||...::.:   ..:.|.|..:||..| .|:|                 :.|...||.:.
  Rat   807 PPESAAASPCKESM---KGSLTVLLDNLQGLS-EAIS-----------------RDDAICLEDNQ 850

  Fly   835 ST-SPPAPP 842
            :| |||:.|
  Rat   851 NTKSPPSNP 859

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm3NP_001188885.2 Pou 1108..1200 CDD:304656
Homeobox 1228..1281 CDD:278475
Cchcr1NP_001002822.2 HCR 110..853 CDD:284517 79/326 (24%)
DUF342 <305..384 CDD:302792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.