DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm3 and ceh-90

DIOPT Version :10

Sequence 1:NP_001188885.2 Gene:pdm3 / 35813 FlyBaseID:FBgn0261588 Length:1292 Species:Drosophila melanogaster
Sequence 2:NP_001024824.1 Gene:ceh-90 / 3565071 WormBaseID:WBGene00010995 Length:193 Species:Caenorhabditis elegans


Alignment Length:66 Identity:22/66 - (33%)
Similarity:31/66 - (46%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1224 KKRKRRTSFTPQALELLNAHFERNTHPSGTEITGLAHQLGYEREVIRIWFCNKRQALKNTVRMMS 1288
            |.:|.|.:|....|.||...||:::||..:|:..||..|......|..||...|..:|.....||
 Worm     3 KSKKTRQNFKIAELGLLKESFEKDSHPGTSEMNRLAGLLNRNEAQINRWFKAMRVKVKKASLKMS 67

  Fly  1289 K 1289
            :
 Worm    68 R 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm3NP_001188885.2 Pou 1108..1200 CDD:473999
Homeodomain 1226..1282 CDD:459649 18/55 (33%)
ceh-90NP_001024824.1 homeodomain 5..61 CDD:238039 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.