DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm3 and Pou3f4

DIOPT Version :9

Sequence 1:NP_001188885.2 Gene:pdm3 / 35813 FlyBaseID:FBgn0261588 Length:1292 Species:Drosophila melanogaster
Sequence 2:NP_058948.1 Gene:Pou3f4 / 29589 RGDID:61947 Length:361 Species:Rattus norvegicus


Alignment Length:374 Identity:114/374 - (30%)
Similarity:159/374 - (42%) Gaps:101/374 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   966 HALSLG---GSP------RLERDYLGNGPSSG------TATSTSSCGAPTAAGSSATANVLSSIN 1015
            ||.|.|   |||      .|:.|||...||:|      ..||.|. |.|   .||..|.  |.::
  Rat    19 HADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSD-GGP---WSSTLAT--SPLD 77

  Fly  1016 RLNASNGELTITKSLGAPT-ATATRASSASPRDDSP-----GPGPSTSSVSHMQPLK-------- 1066
            :.:...|...:  .|||.. ..:...:..||..:.|     .|.|::|..|..|||.        
  Rat    78 QQDVKPGREDL--QLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNSSITSSGQPLNVYSQPGFT 140

  Fly  1067 ---------LSP-----SSRS------EPPHLSPNGNDNDNDLLMDSPNEPTINQATTNVVDGID 1111
                     |:|     |::|      |||.....|:.:    ..|..:|.|...          
  Rat   141 VSGMLEHGGLTPPPAAASTQSLHPVLREPPDHGELGSHH----CQDHSDEETPTS---------- 191

  Fly  1112 LDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSSALAAQMYAAQLSTQQQNMFE 1176
             ||:::|||.||.||:.||.||..||.||....|..:||:.||                   .||
  Rat   192 -DELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTIC-------------------RFE 236

  Fly  1177 KLDITPKSAQKIKPVLERWMKEAEESHWNRYKSGQNHLTDYIGVEPSKKRKRRTSFTPQALELLN 1241
            .|.::.|:..|:||:|.:|::||:.|      :|.....|.|..: .:|||:|||.......:|.
  Rat   237 ALQLSFKNMCKLKPLLNKWLEEADSS------TGSPTSIDKIAAQ-GRKRKKRTSIEVSVKGVLE 294

  Fly  1242 AHFERNTHPSGTEITGLAHQLGYEREVIRIWFCNKRQALKNTVRMMSKG 1290
            .||.:...|:..||:.||..|..|:||:|:||||:||..|   ||...|
  Rat   295 THFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEK---RMTPPG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm3NP_001188885.2 Pou 1108..1200 CDD:304656 32/91 (35%)
Homeobox 1228..1281 CDD:278475 22/52 (42%)
Pou3f4NP_058948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..131 8/31 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..192 11/62 (18%)
POU 186..260 CDD:197673 34/103 (33%)
Homeobox 281..335 CDD:395001 23/56 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 334..361 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.