DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm3 and Pou5f1

DIOPT Version :9

Sequence 1:NP_001188885.2 Gene:pdm3 / 35813 FlyBaseID:FBgn0261588 Length:1292 Species:Drosophila melanogaster
Sequence 2:NP_001009178.1 Gene:Pou5f1 / 294562 RGDID:1359491 Length:352 Species:Rattus norvegicus


Alignment Length:378 Identity:97/378 - (25%)
Similarity:142/378 - (37%) Gaps:113/378 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   921 AGHHGGSLPSGRLSPPSSAPSNSAANSISDRGYTSPLFRTHSPQGHALSLGGSPRLERDYLGNGP 985
            |||.....   ..|||......||.   .:.|:..|  ||.      ||..|.|        :||
  Rat     2 AGHLASDF---AFSPPPGGGDGSAG---LEPGWVDP--RTW------LSFQGPP--------SGP 44

  Fly   986 SSGTATST----------SSCGAPTAAGSSATANVLSSINRLNASNGELTITKSLGAPTATATRA 1040
            ..|..:..          ..||.....|...                .|.:...:|..|......
  Rat    45 GIGPGSEVLGISPCPPAYEFCGGMAYCGPQV----------------GLGLVPQVGVETLQPEGQ 93

  Fly  1041 SSASPRDDSPG--PGPSTSSVSHMQPLKLSPSSRSEPPHLSPNGNDNDNDLLMDSPNEPTINQAT 1103
            :.|....:|.|  .||.|:..|.::..|:.|                       ||.|....:|.
  Rat    94 AGARVESNSEGASSGPCTARPSAVKLEKVEP-----------------------SPEESQDMKAL 135

  Fly  1104 TNVVDGIDLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSSALAAQMYAAQLS 1168
            ..        |:::|||..|.:|::||.||..||..|.|..|..:||:.||              
  Rat   136 QK--------ELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTIC-------------- 178

  Fly  1169 TQQQNMFEKLDITPKSAQKIKPVLERWMKEAEESHWNRYKSGQNHLTDYIGVE---PSKKRKRRT 1230
                 .||.|.::.|:..|::|:||:|::||:.:         .:|.:....|   .::||| ||
  Rat   179 -----RFEALQLSLKNMCKLRPLLEKWVEEADNN---------ENLQEICKSETLVQARKRK-RT 228

  Fly  1231 SFTPQALELLNAHFERNTHPSGTEITGLAHQLGYEREVIRIWFCNKRQALKNT 1283
            |...:....|...|.:...||..:||.:|.|||.||:|:|:||||:||..|.:
  Rat   229 SIENRVRWNLENMFLQCPKPSLQQITSIAKQLGLERDVVRVWFCNRRQKGKRS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm3NP_001188885.2 Pou 1108..1200 CDD:304656 29/91 (32%)
Homeobox 1228..1281 CDD:278475 23/52 (44%)
Pou5f1NP_001009178.1 POU 131..205 CDD:197673 30/100 (30%)
Homeobox 226..280 CDD:395001 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.