DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm3 and POU2F3

DIOPT Version :9

Sequence 1:NP_001188885.2 Gene:pdm3 / 35813 FlyBaseID:FBgn0261588 Length:1292 Species:Drosophila melanogaster
Sequence 2:NP_001231611.1 Gene:POU2F3 / 25833 HGNCID:19864 Length:438 Species:Homo sapiens


Alignment Length:450 Identity:113/450 - (25%)
Similarity:167/450 - (37%) Gaps:139/450 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   858 SPKHSPQGR----MGGSGGSTTTGMNLSQHHERHDR--LERLERQERHERRSHTPTATATRASVS 916
            ||:.:..||    .|....||.....|||....:||  |: ..||.:.|..|.:...|.:.....
Human     3 SPRTAKGGRDIKMSGDVADSTDARSTLSQVEPGNDRNGLD-FNRQIKTEDLSDSLQQTLSHRPCH 66

  Fly   917 SSSSAGHHGGSLPSGRLSPPSSAPSNSAANSISDRGYTSPLFRTHSPQGHALSLG---------G 972
            .|.......|:..||..:.|           ..|.....||.:.....||..|:.         |
Human    67 LSQGPAMMSGNQMSGLNASP-----------CQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPG 120

  Fly   973 SPRLERDYL-----GNG---PSSGTATSTSSCGAPTAAGSSATANVLSSINRLNASNGELTITKS 1029
            ...|:.:.|     .:|   |.:|...::.:.|.|...|||..                      
Human   121 QQGLQPNLLPFPQQQSGLLLPQTGPGLASQAFGHPGLPGSSLE---------------------- 163

  Fly  1030 LGAPTATATRASSASPRDDSPGPGPSTSSVSHMQPLKLSPSSRSEPPHLSPNGNDNDNDLLMDSP 1094
                                    |...:..|: |:         |.||..:|          ..
Human   164 ------------------------PHLEASQHL-PV---------PKHLPSSG----------GA 184

  Fly  1095 NEPTINQATTNVVDGIDLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSSALA 1159
            :||:            ||:|:::|||.||.||:.||.||..||.|:....|..:||:.|      
Human   185 DEPS------------DLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTI------ 231

  Fly  1160 AQMYAAQLSTQQQNMFEKLDITPKSAQKIKPVLERWMKEAEESHWN---RYKSGQNHLTDYIGVE 1221
                         :.||.|:::.|:..|:||:||:|:.:||.|..:   ...|....|::..|  
Human   232 -------------SRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFG-- 281

  Fly  1222 PSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITGLAHQLGYEREVIRIWFCNKRQALK 1281
              :|||:|||........|...|:.|..||..||:.:|.||..|:||:|:||||:||..|
Human   282 --RKRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm3NP_001188885.2 Pou 1108..1200 CDD:304656 31/91 (34%)
Homeobox 1228..1281 CDD:278475 23/52 (44%)
POU2F3NP_001231611.1 POU 185..259 CDD:197673 33/104 (32%)
Homeobox 286..339 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.