DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm3 and Pou1f1

DIOPT Version :9

Sequence 1:NP_001188885.2 Gene:pdm3 / 35813 FlyBaseID:FBgn0261588 Length:1292 Species:Drosophila melanogaster
Sequence 2:XP_006248036.1 Gene:Pou1f1 / 25517 RGDID:3367 Length:317 Species:Rattus norvegicus


Alignment Length:370 Identity:110/370 - (29%)
Similarity:159/370 - (42%) Gaps:80/370 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   937 SSAPSNSAANSI---SDRGYTSPLFRTHSPQGHALSLGGSPRLERDYLGNGPSSGTATSTSSCGA 998
            |..|..||...|   ||.....|| |.|......|                |:|..||:.     
  Rat     2 SCQPFTSADTFIPLNSDASAALPL-RMHHSAAEGL----------------PASNHATNV----- 44

  Fly   999 PTAAGSSATANVLSSINRLNASNGELTITKSLGAPTATATRASSASPRDDSPGPGPSTSSVSHMQ 1063
                 .|...::||.|......:...::| ::| .|||....|..|..   .|..|||..|   .
  Rat    45 -----MSTVPSILSLIQTPKCLHTYFSMT-TMG-NTATGLHYSVPSCH---YGNQPSTYGV---M 96

  Fly  1064 PLKLSPSSRSEPPH-LSPNGNDNDNDLLMDSPNEPTINQATTN----VVDGIDLD-----EIKEF 1118
            ...|:|.....|.| ||.........||.:.|......|....    |.:.||:|     |:::|
  Rat    97 AGTLTPCLYKFPDHTLSHGFPPLHQPLLAEDPTASEFKQELRRKSKLVEEPIDMDSPEIRELEQF 161

  Fly  1119 AKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSSALAAQMYAAQLSTQQQNMFEKLDITPK 1183
            |..||:||:.||.|||.||:||:...|..:||:.||                   .||.|.::.|
  Rat   162 ANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTIC-------------------RFENLQLSFK 207

  Fly  1184 SAQKIKPVLERWMKEAEE--SHWNRYKSGQNHLTDYIGVEPSKKRKRRTSFTPQALELLNAHFER 1246
            :|.|:|.:|.:|::|||:  :.:|. |.|.|          .:||||||:.:..|.:.|..||..
  Rat   208 NACKLKAILSKWLEEAEQVGALYNE-KVGAN----------ERKRKRRTTISIAAKDALERHFGE 261

  Fly  1247 NTHPSGTEITGLAHQLGYEREVIRIWFCNKRQALKNTVRMMSKGM 1291
            ::.||..||..:|.:|..|:||:|:||||:||..|.....:::.:
  Rat   262 HSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm3NP_001188885.2 Pou 1108..1200 CDD:304656 34/96 (35%)
Homeobox 1228..1281 CDD:278475 23/52 (44%)
Pou1f1XP_006248036.1 POU 150..224 CDD:197673 32/92 (35%)
Homeobox 243..297 CDD:395001 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.